PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013610231.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 956aa    MW: 107339 Da    PI: 7.2697
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013610231.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix25.24.1e-081772302275
        trihelix  22 rrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtses 75 
                     +rgk ++ + +ev++++ + g++r +k    kw+n+ ++++k++e+ek++  e+
  XP_013610231.1 177 GRGKTRAEKDREVAEFLNRNGVNRDSKIAGTKWDNMLGEFRKVNEWEKGGDREK 230
                     2457999999**************************************985444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138373.6E-6145228No hitNo description
CDDcd001801.04E-9802945No hitNo description
Gene3DG3DSA:1.10.510.103.1E-6804908No hitNo description
SuperFamilySSF561121.76E-13805945IPR011009Protein kinase-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 956 aa     Download sequence    Send to blast
MGETTKGDAT KPSPNQISSP KDSSLDHQTP TPSPIHHHHQ SFHPSPIFIA TVSSPGAPII  60
PKRPRFISSS GLSPPQWKAL PSPSTLPTAA TFPSLPSPST TVVAASSTET AASSPLEQEG  120
INTEKQQLET DSFQHKFRKG KYVSPVWKPH EMLWLAKAWR VQYQKQETGP GSGSGEGRGK  180
TRAEKDREVA EFLNRNGVNR DSKIAGTKWD NMLGEFRKVN EWEKGGDREK YGKSYFRLSP  240
YERKQHRLPA SFDEEVYQEL ALFMGPRARA LSIKRCIGGA PADVTLTPPS VETLPPILHP  300
PFMTSRDDDV DNNRITSIGR GKRLALSIAG DDHPQYPYTH NIGRGSGLFS NRSYFNPSFE  360
TIPSSSSSLK DLRRIGKIRL TWEESVNLWA EEGEVDYGRI RVSGSSFLNA DELTYLDDSI  420
VACTMESFDD GPLRGFSLDK FISGQHLKVF GRQKSTSSSA PSPSVNMANS IGRAQLPLAV  480
PINKSISTLE FQDPSEHYLS SLRVPAANPP SLFELGRYIQ EPPPENLRFP IRRDVYKDLP  540
PGKELFFSTS TTELLDCRAI TYDIISPVMF RLSPNSVISS KDSLIPLWDD CVNRMVSKFC  600
DMVVLRKPDS SSFVENVQDQ WPNVVGFVKG FGLWRGEEVE KVREGAAVPS SLLVKKILWS  660
YDDLPYILGY HAIGFTVTFC ALSRSSQDRV VCTDLYSFDV SSPSDRIKAL VPCYRLASLL  720
HLLADRCTMR HLCYNDFERI SHRDFVTEIT PNTVTKYYSS KRKWSVVKGI YDFLDQRVPH  780
AEHLNSAREK ELSLSFKPRG VRVKPCNVDH LIESLMCVTR ALVALHDLSF MHRDMRWENV  840
MRSAEMTTTT SDAEWFVCGF DEAAESPQLN PHRSMDEEEE EENGRQAPEM ERGLHAVKVD  900
VWGVGYMIKT CGLTNVPKML RELQGKCLEP NQENRPTAAD CFHHLLQVQS ASSSSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610231.10.0PREDICTED: uncharacterized protein LOC106316914
RefseqXP_013719901.10.0PREDICTED: uncharacterized protein LOC106423678
TrEMBLA0A0D3EA640.0A0A0D3EA64_BRAOL; Uncharacterized protein
STRINGBra028276.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83561624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.14e-08Trihelix family protein